Protein Info for IAI46_21955 in Serratia liquefaciens MT49

Annotation: PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 PF01590: GAF" amino acids 61 to 194 (134 residues), 23.2 bits, see alignment E=3e-08 PF00989: PAS" amino acids 214 to 313 (100 residues), 43.1 bits, see alignment E=1.3e-14 PF00158: Sigma54_activat" amino acids 340 to 500 (161 residues), 129.2 bits, see alignment E=4.7e-41 PF14532: Sigma54_activ_2" amino acids 340 to 504 (165 residues), 67.3 bits, see alignment E=5.9e-22 PF02954: HTH_8" amino acids 596 to 637 (42 residues), 46.5 bits, see alignment 8.4e-16

Best Hits

Swiss-Prot: 57% identical to DHAR_CITFR: Glycerol metabolism operon regulatory protein (dhaR) from Citrobacter freundii

KEGG orthology group: K05880, transcriptional activator for dhaKLM operon (inferred from 95% identity to spe:Spro_4269)

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase operon regulatory protein DhaR" in subsystem Dihydroxyacetone kinases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (648 amino acids)

>IAI46_21955 PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR (Serratia liquefaciens MT49)
MENTSRWQRLIEGELPPAQRPAPAIYASWLRCRSLMQPAVWKAPHCALGATFTSICQRKN
DLLTLGQAALEDACEYMEQRRCLLAILDESGCMLWLCGDVLTRERLQLLGFTPGAYWAEG
DIGTNAPSLAASEGHPIQVRGSEHVRQALHDWSFCATPVYDNSGRQRGSIALGCLLADCA
AGDLSLTLALAREIGNSLNADGLLAESNRHLNQLYGLLDGVDDGVMAWDHRGYLQYINQR
AATLLKLDEQQSQGKPLTQLLTLPALLNRAIAQRQALQHVEVTFESQRQFIATLLTLKPI
FDGERCSFIALLHPLERLRQYVSSQLGRVSHSFEQMPSASLEMRRLIRYGQQAAKGQHPI
LLCGEEGVGKEQLSQAIHNASDRAAGPYIALNCQLLPEAQGLRELLGSDANEEEAGQLSK
FELANGGTLYLEQIEYLPMEMQSALLQVLKTGVVMRLNSNRVIPVDVRVIASSAADLPLL
VQQNRFRRQLFYSLQAFEIQIPALRQRLSDIPLLVKHHLRTLEQHFQCRFRVDDEVMTQL
GLYLWPGNDLELKGVVERTAMMCHGHHLQLADLPEHLLGQQPLLESDPQPGMPLLTLAEM
ERQAIIRAANVSRGQLNEMAQLLGIGRTTLWRKIKQYQIDIRQFKLRA