Protein Info for IAI46_20390 in Serratia liquefaciens MT49

Annotation: N-acetylmuramoyl-L-alanine amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF11741: AMIN" amino acids 38 to 142 (105 residues), 77.3 bits, see alignment E=8.5e-26 PF01520: Amidase_3" amino acids 190 to 404 (215 residues), 173.8 bits, see alignment E=3.5e-55

Best Hits

Swiss-Prot: 75% identical to AMIC_ECOL6: N-acetylmuramoyl-L-alanine amidase AmiC (amiC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01448, N-acetylmuramoyl-L-alanine amidase [EC: 3.5.1.28] (inferred from 98% identity to spe:Spro_3811)

MetaCyc: 75% identical to N-acetylmuramoyl-L-alanine amidase C (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>IAI46_20390 N-acetylmuramoyl-L-alanine amidase (Serratia liquefaciens MT49)
MPNSNHNLGRRRLLQGVAASWLLSVSRVGVAASSHVIAVRVWPSSTYTRVTLESNVELKY
KQFALTNPDRVVVDIEGVQLNSVLKGIVGQVRDDDPYLKQARVGQFDQNTVRLVLELKRS
VTPHMFTLAPVPEYRNRLVMDLYPSKGGSGEDYDPLLALLEDYNKGDLERTLPAEAPQAG
KAGRDRPIVIMLDPGHGGEDPGAIGKFKTREKDIVLQIARRLSTLIKREPNMKVFMTRNE
DVFIPLKVRVAKARKQRADLFVSIHADAFTNRAARGSSVFALSTKGATSSAAKFLAQTQN
ESDLIGGVSKSGDRYLDHTMFDLLQTATINDSLKFGKEVLNRMGKINRLHKNRVDQAGFA
VLKAPDIPSILVETAFISNIEEERKLRTTHFQQQVAESILAGIKAYFANGGAIARGQR