Protein Info for IAI46_18935 in Serratia liquefaciens MT49

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 314 to 332 (19 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 416 to 441 (26 residues), see Phobius details amino acids 452 to 476 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 51 to 476 (426 residues), 275.3 bits, see alignment E=4.5e-86 PF03448: MgtE_N" amino acids 61 to 161 (101 residues), 84.9 bits, see alignment E=7.9e-28 PF00571: CBS" amino acids 228 to 282 (55 residues), 32.2 bits, see alignment 1.7e-11 PF01769: MgtE" amino acids 348 to 471 (124 residues), 113.3 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 97% identity to spe:Spro_3545)

Predicted SEED Role

"Magnesium transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>IAI46_18935 magnesium transporter (Serratia liquefaciens MT49)
MSAATHNVKKVAEYRQRILSLLLNNKDLVDGILGRPGDENALSKSELLNQTAEITGLLDD
MHAADLADLLEALPQDERLALWRLVGNAKRGQTLVEVAEPVWDSLIEEMSDKDLLKAIKT
LDVDEQAYLAQYLPRNLMGRLLTSMEPDQRAQVREMIHYGKDTVGWMMDFELVTVRPDVT
IGAVHRFLRLRKTIPEATDKLFVTDRKNTLLGELPLTAVLLNDPETLVQTVMDSDPTSFQ
PDDKAEAAASAFERYDLISAPVVDAKGKLMGRLTIEEIVDVVNEESDSNLRRMGGLSPEE
DVFAPVSKAVKTRWAWLAINLCTAFIASRVIGLFEHTISQLVALAALMPIVAGIGGNTGN
QTITMIVRALALHQIEVGNISRLMFRELGVAIINGVVWGGIMGVVTWLLYGDWAMGGVMT
LAMILNLLVAALMGVVIPMTMLKLGRDPAVGSSVLITALTDTGGFFIFLGLATLFLL