Protein Info for IAI46_15725 in Serratia liquefaciens MT49

Annotation: deferrochelatase/peroxidase EfeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01412: Tat-translocated enzyme
  • amino acids 16 to 430 (415 residues), 574.6 bits, E=1.2e-176
• PF04261: Dyp_perox_N
  • amino acids 71 to 222 (152 residues), 151.7 bits, E=1.5e-48
• TIGR01413: Dyp-type peroxidase family
  • amino acids 71 to 419 (349 residues), 339.8 bits, E=1.8e-105
• PF20628: Dyp_perox_C
  • amino acids 235 to 419 (185 residues), 176.5 bits, E=3.8e-56

Best Hits

Swiss-Prot: 78% identical to EFEB_YERPS: Deferrochelatase/peroxidase EfeB (efeB) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 94% identity to srs:SerAS12_3009)

MetaCyc: 76% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from glycine (8/8 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (6/6 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• heme b biosynthesis II (oxygen-independent) (4/4 steps found)
• heme b biosynthesis V (aerobic) (4/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Protein Sequence (432 amino acids)

>IAI46_15725 deferrochelatase/peroxidase EfeB (Serratia liquefaciens MT49)
MSNKIGPENGPHPQTQGAASPSRRRLLQGLGLGVLALGGSRLTQAADKTAEPLAVAKDER
WQKQPFYGAHQAGILTPQQAAMMLVAFDVLASNKQDLERLFRLLTNRIAFLTTGGKAPEV
DPKLPPLDSGIMGPEIYPDNLTITVSVGTSLFDERFGLQAHKPLRLQKMTRFPNDSLDAS
LCHGDLVLQICANTNETVIHALRDIIKHSPDLLSVRWKREGFISAHAARSKGKETPINLL
GFKDGTANPKTDDKPLMDQVVWVADNVGEPAWAVGGSYQAARIIRFHVEFWDRTPLQEQQ
TIFGREKHSGAPLGMKHEHDEPDYEKDPEGKMIPMDAHIRLANPRTPQTHSNLLLRRGYS
YSIGVSNSGQLEMGLLFVCYQADLEKGFLTVQKRLNGEALEEYVKPIGGGYFFALPGVKD
SNDYLGSGLLKA