Protein Info for IAI46_13035 in Serratia liquefaciens MT49

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details PF00892: EamA" amino acids 4 to 140 (137 residues), 55.9 bits, see alignment E=2.7e-19

Best Hits

Swiss-Prot: 67% identical to YTFF_ECOLI: Inner membrane protein YtfF (ytfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to spe:Spro_2538)

Predicted SEED Role

"FIG006442: Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>IAI46_13035 DMT family transporter (Serratia liquefaciens MT49)
MFVGVLFALSAGLMWGLIFVGPVLIPEYPAALQSTGRYLAFGLIALPLAWFDRHRLKKLH
RHDWLEALKLTAIGNLLYYLCLASAIQRTGAPVSTMIIGTLPVVISVTANLFYSQHDGRL
SWRKLTPALVLIACGLALVNVAELQGNTAPVDVWRYTSGLGLAVLAVACWTWFPLRNARW
LRENPGQRSATWATAQGLVTLPLALIGYVVVCGQLAFTQPEFALPFGPRPEVFVPLMIAI
GMLCSWIGALCWNEASQRLPTVLVGPLIVFEILAGLAYTFMLRQAWPPLLTLGGIACLIV
GVVSAMRIKPQPVVVSIGAKE