Protein Info for IAI46_10920 in Serratia liquefaciens MT49

Annotation: HAAAP family serine/threonine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 97% identity to spe:Spro_2139)

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>IAI46_10920 HAAAP family serine/threonine permease (Serratia liquefaciens MT49)
MSTISPDSGTLATAQAAKWNKTDTVWMFGLYATAVGAGTLFLPINAGLNGPLVLLLMALF
AFPLTYLPHRALSRFVLSGSSRDGNIHDVVVEHFGVLAGKIIMVLYLMAFFPIVLVYSIS
ITNALDSFLIHQFHLAPLPRVWLSLAVVVVLNLVLLRGKDAIVSAMGMLVFPLLVFLMGI
SLYLVPTWQTANFVSGLANTQFSSPDLWHSLWLAVPVMVFSFSHAPIISSFASTQKSLYG
EKAERRCARIMRYSYVLICVTVLFFVFSCVLSLSHEDMQQAKDQNITVLTTLANKFSNPL
IAYLGPMMAMLAMAKSYLGTSLGVTEGATSLIDGLTRAVGKPLSSRVTHRISAISLFLLT
WAATVWNPSALHIIETISGPLIAAILFILPMYAVRAVPAMRRYRALSNVFVLVMGLIALS
ALIYGLI