Protein Info for IAI46_09990 in Serratia liquefaciens MT49

Annotation: prolyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR01249: prolyl aminopeptidase" amino acids 13 to 314 (302 residues), 413.3 bits, see alignment E=2.9e-128 PF12697: Abhydrolase_6" amino acids 41 to 298 (258 residues), 44.8 bits, see alignment E=3.7e-15 PF00561: Abhydrolase_1" amino acids 41 to 297 (257 residues), 113.7 bits, see alignment E=1.8e-36 PF12146: Hydrolase_4" amino acids 62 to 152 (91 residues), 37 bits, see alignment E=3.6e-13

Best Hits

Swiss-Prot: 94% identical to PIP_SERMA: Proline iminopeptidase (pip) from Serratia marcescens

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 98% identity to spe:Spro_1940)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>IAI46_09990 prolyl aminopeptidase (Serratia liquefaciens MT49)
MEQLRGLYPPLAAYDSGWLDTGDGHRIYWELSGNPNGKPAVFIHGGPGGGISPYHRQLFD
PQRYKVLLFDQRGCGRSKPHASLDNNTTWHLVQDIERLREMAGVDQWLVFGGSWGSTLAL
AYAQTHPQRVSEMVLRGIFTLRKQELHWYYQDGASRFFPEKWERVLSILSEEERKDVIAS
YRQRLTSTDPQVQLEAAKLWSVWEGETVTLLPSSESASFGEDDFALAFARIENHYFTHLG
FLDSDDQLLRNVPLIRHIPAVIIHGRYDMACQVQNAWDLGKAWPEAELHIVEGAGHSFDE
PGILHQLMLATDKFAGK