Protein Info for IAI46_09675 in Serratia liquefaciens MT49

Annotation: LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 5 to 306 (302 residues), 475.6 bits, see alignment E=3.4e-147 PF03279: Lip_A_acyltrans" amino acids 5 to 297 (293 residues), 353.2 bits, see alignment E=5.5e-110

Best Hits

Swiss-Prot: 68% identical to LPXL_ECO57: Lipid A biosynthesis lauroyltransferase (lpxL) from Escherichia coli O157:H7

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 99% identity to spe:Spro_1884)

MetaCyc: 68% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>IAI46_09675 LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee (Serratia liquefaciens MT49)
MTQVPSFNRSLLHPRYWLTWFGIGLLYLLVLLPYPIIYRLGTWLGRFSMRFLKRRVAIAQ
RNLVLCFPDMPQAERDALVVQNFESVGMGLFETGMAWFWPNWRIERWFKVSGLEHIQKAR
DNHQGVLLIGLHFLTLELGARIFGIHNPGIGVYRPHDNKLMDWLQTWGRMRSNKSMLDRK
DVKGMIRALKQGDIIWYAPDHDYGPRSSVFAPLFAVEKAATTTGSYVLVRMGKPAIIPFT
PRRLPDAKGYELIMQPAVENFPLDNELEAAAFMNKVVEKEILMAPDQYMWLHRRFKTRPE
GEPSLY