Protein Info for IAI46_09045 in Serratia liquefaciens MT49

Annotation: pyrimidine utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR03614: pyrimidine utilization protein B" amino acids 22 to 241 (220 residues), 438.3 bits, see alignment E=3.1e-136 PF00857: Isochorismatase" amino acids 37 to 234 (198 residues), 143.1 bits, see alignment E=4.9e-46

Best Hits

Swiss-Prot: 94% identical to RUTB_SERP5: Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09020, putative isochorismatase family protein RutB [EC: 3.-.-.-] (inferred from 94% identity to spe:Spro_1822)

MetaCyc: 83% identical to ureidoacrylate amidohydrolase / (+)-gamma-lactamase monomer (Escherichia coli K-12 JM109)
3.5.2.-; RXN0-6460 [EC: 3.5.1.110]

Predicted SEED Role

"Predicted amidohydrolase RutB in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.- or 3.5.1.110

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>IAI46_09045 pyrimidine utilization protein B (Serratia liquefaciens MT49)
MKIVESQPVVRRHSPQGGATVTLPARPEAIAFAPQETALIVVDMQNAYASQGGYLDLAGF
DVSTTAPVIANIKRAITAARAAGIKVIFFQNGWDNQYVEAGGEGSPNWHKSNALKTMRQR
PELMGKLLAKGDWDYDLVDELQPQPGDIVLPKPRYSGFFNTQLDSLLRSYGIHHLVFTGI
ATNVCVESTLRDGFFLEYFGIVLADATHQAGPAFAQQAALYNIETFFGWVSDVDSFCDVL
AAPLSQTA