Protein Info for IAI46_09005 in Serratia liquefaciens MT49

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00126: HTH_1" amino acids 23 to 79 (57 residues), 72.3 bits, see alignment E=2.5e-24 PF03466: LysR_substrate" amino acids 106 to 302 (197 residues), 69.8 bits, see alignment E=2.2e-23

Best Hits

KEGG orthology group: None (inferred from 89% identity to spe:Spro_1815)

Predicted SEED Role

"TrpBA operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>IAI46_09005 LysR family transcriptional regulator (Serratia liquefaciens MT49)
MKTDDFGEKNSRKISRPLSLGGLRCFEAAARLESFTQAANSLNLTHGAVSRAVRALEDEL
GIALFERRHRRVYLTAAGRTLFQASQQAFGILEQTAQQLRQQAQDAPLVLSCEPTLLMRW
LIPRLPAFQLAHPDIHLQLVAGGGPFSFHDGISAALRRNDFDWGDKLHSQWLFNEQVGPV
CKPEMLPRFIALHAGQPQLSRDAVLLHSATRPDAWRHWAQQQSVSLEGCPEQRFDHFYFS
LQAAVAGIGVAIGPWQQVRDDVAGGLLSAPFGFTSDGSGYCLLTPQEIRPGSALARLADW
LKLSAGA