Protein Info for IAI46_08105 in Serratia liquefaciens MT49

Annotation: TolC family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 28 to 456 (429 residues), 389.8 bits, see alignment E=8e-121 PF02321: OEP" amino acids 31 to 228 (198 residues), 92.7 bits, see alignment E=1.3e-30 amino acids 255 to 437 (183 residues), 114.7 bits, see alignment E=2.4e-37

Best Hits

KEGG orthology group: K12538, outer membrane protein HasF (inferred from 96% identity to spe:Spro_1598)

Predicted SEED Role

"ABC exporter for hemopore HasA, outer membrane component HasF" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>IAI46_08105 TolC family outer membrane protein (Serratia liquefaciens MT49)
MIQFKRQVAGLAISTLLFAISAPVHSIGILDAYSLALEKDPTFRAAIKEKEAGDENENIG
RAGLLPKVSANYQNSPRNWQTQKYPASDIFGNSLGEATKRQQYRSHSSSITLTQPLFDYE
AYARYKAGVAQTLMSDERYRSKYLDLAVRVISAYVEVAYSKDQIALASAQKAAYKEQLAL
NDRLMSAGEGTITDVSETQARYSLAEAQEIEARDALDAAQRELEVIIGVPLDQLDELQVL
RPGKFQVAPLIPSKFEEWQKIALENNPMLAASRHGVDAAKYEVERNRAGFMPQVQLYASH
SENDSSSDNTVNQKYRTDSIGVQVSVPIYAGGGVSASTRQAASRYGQAMYEMDAQVGTTL
NDLRKQFNLCISSRAKLAAYELAVKSATTQVTATRQSVLAGQRVNVDVLNAEQQLYSAQR
DLASAKYTYIKSWITLLSDSGTLDEKDVKRVAQYFSMNR