Protein Info for IAI46_08100 in Serratia liquefaciens MT49

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 21 to 443 (423 residues), 389.5 bits, see alignment E=1e-120 PF00529: CusB_dom_1" amino acids 35 to 399 (365 residues), 61.4 bits, see alignment E=1.6e-20 PF00364: Biotin_lipoyl" amino acids 65 to 94 (30 residues), 23.1 bits, see alignment (E = 1.3e-08) PF13533: Biotin_lipoyl_2" amino acids 65 to 107 (43 residues), 37.5 bits, see alignment 4.1e-13 PF13437: HlyD_3" amino acids 295 to 397 (103 residues), 50.6 bits, see alignment E=6.9e-17

Best Hits

Swiss-Prot: 47% identical to PRTE_DICCH: Proteases secretion protein PrtE (prtE) from Dickeya chrysanthemi

KEGG orthology group: K12537, protease secretion protein HasE (inferred from 97% identity to spe:Spro_1597)

Predicted SEED Role

"Alkaline protease secretion protein aprE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>IAI46_08100 HlyD family type I secretion periplasmic adaptor subunit (Serratia liquefaciens MT49)
MSTHIGEPQDSYSEEIPQDERRFTRMGWLVVGLGLFGFFAWAAFAPLDKGVASPGSVIVS
GNRKTVQAPASGIIKSITVKEGDRVKAGEVLVQLSQVQAQAQVDSLRDQYYTTLATEGRL
LAERDGLSKVTFSPVFEQLQAQPRVAEIIALQTQLFSSRRQGLQSEVDGYKQSMDGMRFQ
LKGLQDSRVNKQIQLSSLREQMNSMKQLAADGYLPRNRYLEVQRQFAEVNSSIDETVGRI
GQVQKQLQESQQRIDQRFADYQREVRTQLAQTQMDASEFRNKLEMANFDLGNTAITSPVD
GTVVGLNIFTQGGVVGAGDHLMDVVPSQATLVVDSRLKVELIDKVYNGLPVDLMFTAFNQ
NKTPKIPGTVTLVSADRLVDKANGEPYYQMQVTVSPEGMKMLGGEDVKPGMPVEVFVKTG
SRSLLSYLFKPILDRAHTSLTEE