Protein Info for IAI46_06005 in Serratia liquefaciens MT49

Annotation: CNNM family magnesium/cobalt transport protein CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF21917: NMB0537_N" amino acids 29 to 63 (35 residues), 46.9 bits, see alignment 2.7e-16 PF00571: CBS" amino acids 69 to 124 (56 residues), 37.1 bits, see alignment E=4.7e-13 amino acids 142 to 189 (48 residues), 26.6 bits, see alignment 9.4e-10 PF03471: CorC_HlyC" amino acids 206 to 281 (76 residues), 80.3 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 88% identical to CORC_ECOL6: Magnesium and cobalt efflux protein CorC (corC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 100% identity to spe:Spro_1216)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>IAI46_06005 CNNM family magnesium/cobalt transport protein CorC (Serratia liquefaciens MT49)
MSDDHSQSNDSPSPKKGFFTLILNQLFHGEPKNRGDLVELIRDSEQNDLIDPDTRDMLEG
VMDIAEQRVRDIMIPRSQMVTLKRNQTLEECLDVIIESAHSRFPVISEDKDHIEGILMAK
DLLPFMRAESEEFSIDKVLRTAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVT
IEDILELIVGEIEDEYDDEDDLDIRQLSRHMYTVRALAPIEDFNEAFGTHFSDDEVDTIG
GLVMQAFGHLPARGETIEIEGYLFKVAMADSRRIIQVHVKIPDDSPQPKLEE