Protein Info for IAI46_04775 in Serratia liquefaciens MT49

Annotation: phosphate response regulator transcription factor PhoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR02154: phosphate regulon transcriptional regulatory protein PhoB" amino acids 1 to 226 (226 residues), 379.7 bits, see alignment E=2e-118 PF00072: Response_reg" amino acids 5 to 117 (113 residues), 98.6 bits, see alignment E=2.5e-32 PF00486: Trans_reg_C" amino acids 151 to 225 (75 residues), 101.1 bits, see alignment E=2.9e-33

Best Hits

Swiss-Prot: 91% identical to PHOB_ECO57: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Escherichia coli O157:H7

KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 100% identity to srs:SerAS12_0966)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>IAI46_04775 phosphate response regulator transcription factor PhoB (Serratia liquefaciens MT49)
MARRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRLSEPFPDLVLLDWMLPGGS
GIQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVM
RRISPMAVEEVIEMQGLSLDPSSHRVMANEQALDMGPTEFKLLHFFMTHPERVYSREQLL
NHVWGTNVYVEDRTVDVHIRRLRKALETSGHDKMVQTVRGTGYRFSTRY