Protein Info for IAI46_04080 in Serratia liquefaciens MT49

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 254 to 273 (20 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 424 to 444 (21 residues), see Phobius details amino acids 628 to 647 (20 residues), see Phobius details amino acids 656 to 675 (20 residues), see Phobius details amino acids 681 to 700 (20 residues), see Phobius details amino acids 712 to 731 (20 residues), see Phobius details amino acids 737 to 760 (24 residues), see Phobius details PF03176: MMPL" amino acids 240 to 395 (156 residues), 32.4 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: None (inferred from 93% identity to spe:Spro_0898)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (768 amino acids)

>IAI46_04080 MMPL family transporter (Serratia liquefaciens MT49)
MRPELHRRLAFGWLAICLLLIAALCWLLPRSQINSSVLALLPKQQLVGVPDELADGFSRR
LDRQLMWLVSPPPGADNAAVDWWWQQLRQMPELQRVGGPMDAQRQQQWGRFFYQHRNVLL
DDATRQRLQQGADAQSQWILGQLYSAFAGVSGKELANDPLMLVRASQLAQQQNGGLLSLS
KGWLVARDVQGRSWYLLHAELSASSYDISSARLTVDKLTALQQQLQQRWPGTEVLSRGTL
FYSNYASQQAEKDISTIGLASVAGVFLLVLFMFRSPLPLLLCALSVGIGALAGTVATLLA
FGEIHLMTLVLSISIVGISADYTLYFLTERMVHGRQSTPLASLQKLLPALSMALLTTVVA
YLALLIAPFPGLQQLAVFAAAGLSAACITVICWYPQLSRRLPVRPAPGLTLILNWLHAWR
HRPLLRYGLPGAVLLLVVAGFSQLKVDDDIGQLQALPVALQQQEQRIAALTGQHNDQKWL
VVYGANAEQLLQSIELLQPKLAEAKRQGVLADYRLLPLPSLQRQQENIALLQRVAPQVMN
NLQQAELVLSTPDLTPEWVSPQQWLGSVVSEGWRLLWLTLPDGRSAALVPVNGVKNSAMM
KTLAEQVPGTGWIDRKTEFSDLFGQYRLYLSYLLALSVAAIALIYLWRFGLRHGLRCMVP
TLLSLGSGIAVLALSGHTLNLFSLLALVLVLGIGINYTLFFTNPRGTPTTSMFAIFMAVF
TTQLTFGMLVLSHTQAISSFGIVLSSGIAVAFLLAPLTLVSKRKRGKA