Protein Info for IAI46_03630 in Serratia liquefaciens MT49

Annotation: methionine gamma-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 7 to 395 (389 residues), 577.3 bits, E=7.1e-178
• PF01053: Cys_Met_Meta_PP
  • amino acids 11 to 393 (383 residues), 466.8 bits, E=1e-143
• PF06838: Met_gamma_lyase
  • amino acids 54 to 246 (193 residues), 29.2 bits, E=9.1e-11
• PF01041: DegT_DnrJ_EryC1
  • amino acids 64 to 282 (219 residues), 21.2 bits, E=4e-08
• PF00155: Aminotran_1_2
  • amino acids 66 to 278 (213 residues), 38.2 bits, E=2.7e-13
• PF00266: Aminotran_5
  • amino acids 92 to 234 (143 residues), 27.5 bits, E=3.9e-10

Best Hits

Swiss-Prot: 66% identical to MEGL_PSEPU: L-methionine gamma-lyase (mdeA) from Pseudomonas putida

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 95% identity to spe:Spro_0798)

MetaCyc: 66% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• L-methionine degradation II (3/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Protein Sequence (396 amino acids)

>IAI46_03630 methionine gamma-lyase (Serratia liquefaciens MT49)
MSAIFRQAFATRAIHHGYDPQQYLGALCPPVFMSSTFTFPTAEYGGACFEGTEPGYFYSR
IANPTLNLLEQRIANLEGGEAAVAFSSGMGAITACCWTLLNPGDELIVDETIYGCTFSYF
HHGLARYGVKITHVDLTRPERLAAAIGPRTRMVYCETPANPNMRLVDIAAVAEIAHRQQA
LLLVDNTYCTPYLQRPLEQGADIVVHSATKYIGGHGDLLAGLVVTRQDLAQDIRLVGLKD
MNGAVLSAQDAALLLRGLKTLPLRMERHCDNAQRLAEMLAQHSAVERVYYPGLEDFPQYE
LAQRQMARPGGMLAFELKGGMAAGIRFLNALRLILRAVSLGDCESLAQHPASMTHSAYSP
EERQRHHISDGLIRLSAGLEDLGDLQADIRQALAQS