Protein Info for IAI46_03460 in Serratia liquefaciens MT49

Annotation: cell division protein FtsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR01174: cell division protein FtsA" amino acids 9 to 385 (377 residues), 534.4 bits, see alignment E=7.4e-165 PF02491: SHS2_FTSA" amino acids 85 to 162 (78 residues), 102.6 bits, see alignment E=2.4e-33 PF06723: MreB_Mbl" amino acids 173 to 360 (188 residues), 38.3 bits, see alignment E=1.5e-13 PF14450: FtsA" amino acids 207 to 381 (175 residues), 130.5 bits, see alignment E=9.4e-42

Best Hits

Swiss-Prot: 95% identical to FTSA_ECOL6: Cell division protein FtsA (ftsA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to srr:SerAS9_0699)

Predicted SEED Role

"Cell division protein FtsA" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>IAI46_03460 cell division protein FtsA (Serratia liquefaciens MT49)
MIKSTDRKLVVGLEIGTAKVSALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKC
VQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVR
VRDEHRILHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGL
KVDQLIFAGLAASYAVLTEDERELGVCVVDIGGGTMDMAVYTGGALRHTKVIPYAGNVVT
SDIAYAFGTPPTDAEAIKVRHGCALGSIVSKDESVEVPSVGGRPPRSLQRQTLAEVIEPR
YTELLNLVNDEILQLQEQLRQQGVKHHLAAGIVLTGGAAQIDGLAACAQRVFHTQVRIGQ
PLNITGLTDYAQEPYYSTAVGLLHYGKESHLSGEAEVEKRASVGNWFKRINSWLRKEF