Protein Info for IAI46_03230 in Serratia liquefaciens MT49

Annotation: PhoX family phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details PF05787: PhoX" amino acids 58 to 598 (541 residues), 594.3 bits, see alignment E=1.5e-182

Best Hits

KEGG orthology group: K07093, (no description) (inferred from 98% identity to spe:Spro_0721)

Predicted SEED Role

"Putative phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>IAI46_03230 PhoX family phosphatase (Serratia liquefaciens MT49)
MTTKIEQLDADRLTDPTRRKLLLGSAGAVGLAGFLGGGIWTVSAQALAEDLPPNKLLGFK
GIAASTADEVAIAPGYRAEVLISWGEPLVEGAAAFDPQGNNSAADQEKQFGDNNDGMSFF
PIDDNHGVMAINNEYVNEQYLFAHGGTKATSLEDVRKSQAAHGVSIVAVRRVGDSQRWEV
ERPSRYNRRITANTEMQFSGPAAGHALLQTAADPGGRKVLGTFGNCANGKTPWGTYLTCE
ENFDTYFGTHQADYKTTADQKRYTLKVSEPERNWPDYDERFDVAKNPNEFNRHGWIVEID
PMNPGSTPIKHTALGRFKHENAAVTVAKDGRLVVYMGDDERGEHIYKYVSKGVVDVANPA
NNRSLLDEGTLYVAQFDGDANGTPLKGTGRWIALEFGKNGLTPENGFRDEAEVLIFARKA
AAQVGATKMDRPEWIAVNPHDGRAYCTLTNNSKRGEEGMPLNAANPRPNNVYGQIIRWDE
GGDATAASFNWDIYALCGNPIAHPEGVNRGTPNITADNTFNSPDGLGFDKTGRLWILTDG
KYSNKGDYAGQGNNQMLVGDPQSGEIRRFMVGPKSCELTGITFTPDYKTMFVNVQHPGED
GDSHFPNNSPRPRSSVLMITREDGGVIGA