Protein Info for IAI46_02000 in Serratia liquefaciens MT49

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 20 to 20 (1 residues), see Phobius details transmembrane" amino acids 21 to 37 (17 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details amino acids 217 to 243 (27 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 21 to 358 (338 residues), 122.9 bits, see alignment E=1.7e-39 PF01061: ABC2_membrane" amino acids 161 to 328 (168 residues), 52.7 bits, see alignment E=4.2e-18

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 95% identity to srs:SerAS12_0443)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>IAI46_02000 ABC transporter permease (Serratia liquefaciens MT49)
MKLYWQTFVRVLLGMLERPMWLMLILSLCVMSMVYANRTVWDLPVGVIDQDHSTASRQLI
RQLDATSKIAIETYDSLEQAQRDLGWRKLFAVIIMPVDLEKKILSGQNIVVPVYGDATNR
LANGQIQQDVVAAYQQLLTQYNNGLLLRSGFSERQAQVILTPIVGQTLDVFNPGISFAAI
IFPGLLVMLLQHSLLIACVRVSIAMKSMPGGKAPLAAHLGGLTALLPIWLFLSIVLFVLW
PWVLGYRQTAGIAEILLLTFPFLLAVLGLGKLVTECLRSVEMIYLTLAFITTPIFYLSGT
IWPLQAMPGWVRAISYSIPSTWATKAVAGVNQMGLSLNEVWGDVAMLLVLGIVYTLLGFG
VGFVRNSVALRSMFRKRQVN