Protein Info for IAI46_00620 in Serratia liquefaciens MT49

Annotation: dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR02382: TDP-D-fucosamine acetyltransferase" amino acids 44 to 237 (194 residues), 273.1 bits, see alignment E=5.2e-86 PF13302: Acetyltransf_3" amino acids 92 to 226 (135 residues), 30.5 bits, see alignment E=1.1e-10 PF00583: Acetyltransf_1" amino acids 133 to 225 (93 residues), 45.1 bits, see alignment E=2.4e-15 PF13508: Acetyltransf_7" amino acids 144 to 225 (82 residues), 33.2 bits, see alignment E=1.1e-11 PF13673: Acetyltransf_10" amino acids 144 to 225 (82 residues), 27.6 bits, see alignment E=5.1e-10

Best Hits

KEGG orthology group: None (inferred from 83% identity to srr:SerAS9_0129)

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>IAI46_00620 dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase (Serratia liquefaciens MT49)
MRVHANIEPLAWESEFFALGSARLNFSTTAPALTEAGLAAYALVQAKIPAHQTAWADALS
GLGFQLVEAEVDLLLNIGTECASSQSALPPAIRLAVPEDIPVLRAAAANVFTASRFRAPW
YDVQDSGRFYAAWIEKAVLGTFDHQCLLALDEAGQPEGFVSLRDIGGQEVRIGLLAAFPG
ASGKGIGARLMAAAIAECRKDSRMRLRVATQLGNIAALRLYQRQGAVIESTSYWLYRGKH
DPI