Protein Info for HUW76_08125 in Fusobacterium nucleatum SB010

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 PF13181: TPR_8" amino acids 73 to 101 (29 residues), 22.2 bits, see alignment (E = 8.5e-08) amino acids 562 to 589 (28 residues), 13.2 bits, see alignment (E = 6.3e-05) amino acids 677 to 705 (29 residues), 19.5 bits, see alignment (E = 6.2e-07) PF13174: TPR_6" amino acids 73 to 94 (22 residues), 13.4 bits, see alignment (E = 7.9e-05) PF07719: TPR_2" amino acids 73 to 101 (29 residues), 24.7 bits, see alignment (E = 1.3e-08) PF13424: TPR_12" amino acids 426 to 484 (59 residues), 30.9 bits, see alignment 2e-10 amino acids 677 to 743 (67 residues), 33.7 bits, see alignment E=2.6e-11 PF13432: TPR_16" amino acids 681 to 739 (59 residues), 19.2 bits, see alignment 1.1e-06

Best Hits

KEGG orthology group: None (inferred from 89% identity to fnu:FN1434)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (810 amino acids)

>HUW76_08125 tetratricopeptide repeat protein (Fusobacterium nucleatum SB010)
MKDDMLKKIEDLYDLDKHQEIIDMIEALPAEQLNNELIGQLGRAYNNVGKYEKAIEILKS
IEIEEGNTMRWNYRIGYSYYYLGDYENAEKYFLKAHKIDSEDEDVKRFLLDIYIELSKQA
IDKEDNQDKALEYALKSKEYISTNDDRIQCDSYLAWLYDKIGVFDVAEELLKNIISLGRD
DAWINSELAYCLGELNKFEESLEHYLRAKELGREDDWIYSQIGWTYRRLEKYEEALKADF
KAQELGQNDAWVNVEIGICYKELEKFEEALKYYLVANELNEGKNLWILSEIAWVYGVMEN
YDEELKYLEQTKKLGRKDEWINAEYGKVYYKLEQYKKALRFFNKAKKLGQNDAWINVQIA
RCYKALDKNEDALKAYLKAEKFEENDAWLLSEIAWLYDGLGKYKEGLKYLKRIEKLGRDD
CWFNTEYGFCLMRMQKYDKAIEKYKHALELKEELNEEIYLNCQLGFCYRLLEKYKEALKY
HLKGQELGRNDAWINIEIGLCYKELENYEKALEHYLIAYEQDKEDTWLLSDIGWIYNELE
KYDDGLQFLQKAQELGREDSWIYAEIGQCLGRLGKYEEGIEKLKKALEILEEDKTNDNVD
EKIFINSEIGWLYGKIENSDPNEALHYLYAARDLGRDDQWLNAEIGWELGYNDKDKDEEA
VKYFERSIELGRDDEWVWARIANIYFDLERYEDALKAYNRAYELEGAYKEGKDSLYICSI
GRTLRRLGRYEEAIEKLLESRRLSLEEGDVVDLEDLELAYCYAVLGNKEKAEEHMKLSID
SLGTYAESEEYLKKQFDEIREMINVLSHPS