Protein Info for HUW76_08065 in Fusobacterium nucleatum SB010

Annotation: peptidoglycan DD-metalloendopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01551: Peptidase_M23" amino acids 311 to 403 (93 residues), 72.5 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 93% identity to fnu:FN0266)

Predicted SEED Role

"membrane protein related to metalloendopeptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>HUW76_08065 peptidoglycan DD-metalloendopeptidase family protein (Fusobacterium nucleatum SB010)
MSLKMMKTKIFLTFFLLSASIYPASVKDMNKRLKNIDKEIEKKNTRIKAIDTETSKLEKM
IKDLEDEIKKLEHEREEIEDEITVVKKNIDYSRKNLEISEVEHDRKESEFVAKIIAWDKY
SKVHRKEIDEKVLLTKNYREMLHGDLQRMGHIEKVTGSIKEAKEKVEAEKKKLDRLEAEL
KENLRKSDAKKEEQKKLKEKLQVEKKGHQSSIEKLKKEKQRISKEIERIIRENARRAAEK
AAREKAAREAAKNKGKGKGKSSGGTKVTTTTVDMPKISNPEAYKRIGKTIKPLNGQIVVY
FGQKKAGVVESNGIEIKGKLGNPIVASKGGTVIYANAFQGLGKVVMIDYGGGIIGVYGNL
LAIKVGLNSRVSAGQTIGVLGLSSDKEPNLYYELRANLRPIDPIPTF