Protein Info for HUW76_06110 in Fusobacterium nucleatum SB010

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 62 to 92 (31 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 23 to 292 (270 residues), 80.9 bits, see alignment E=1.3e-26 PF00005: ABC_tran" amino acids 352 to 500 (149 residues), 98.2 bits, see alignment E=6.3e-32

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 97% identity to fnu:FN0614)

Predicted SEED Role

"Export ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>HUW76_06110 ABC transporter ATP-binding protein (Fusobacterium nucleatum SB010)
MKQKSNFTFLLSYAKNEKYKLYLSAFLSVCSSILMVVPYILIYNIILELLKTDLDYNRIK
KLAIYTAILIVLRLVLFILSGVFSHVAAFNILYNIRMQAVKHLGNINLGYFREKNIGEIK
KAINEDVEKLENFLAHQIPDLAAAITTPIVILVFLFFLEWRIAIFLIIPIILAILTQFAM
FKGYGKRLDKYNSLLQRLTSTITQYIKGMNVFKAFNLTAHSFKKYIDINNEYTENWHSMT
DDFKNPYGVFLAVVDSALIFVIPSGGYLYLTDKINISTFLIFLLLSYTFLTSLKTLMQFA
GTFSFVLAGANNVRSMIEFPIQNDGKNLKDINFKEDISFNDVTFSYDKNDVLKNINLILR
PNTITALVGPSGSGKTTIAYLLGRFWDIQKGSIKIGDIDIKDIDVNYLLSNISYVFQDIF
MLTDTIFENIKMGLDKTKEEVYQAAKDAEIHEFIMSLPNGYDTIIGDGYIKLSGGEKQRI
SIARCLLKNSPIVVLDEITAYSDIENEAKIQNAIRNLLKDKTAIIIAHRLYTIKDVDNIV
VLNEGEIVESGKHQDLITKENGLYKHLWEVK