Protein Info for HUW76_06030 in Fusobacterium nucleatum SB010

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 75 to 100 (26 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 333 to 359 (27 residues), see Phobius details PF00375: SDF" amino acids 10 to 381 (372 residues), 283.4 bits, see alignment E=1.5e-88

Best Hits

KEGG orthology group: None (inferred from 93% identity to fnu:FN1148)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>HUW76_06030 dicarboxylate/amino acid:cation symporter (Fusobacterium nucleatum SB010)
MEKEKKGDTLIIKLVLGVIIGIIIGLVSNEQVISVILPIKFFLGELIFFVVPFIIIGFIA
PAITQLKANASKMLLTMLGLSYLSSVGAAFFSATAGYILIPKLHIVSDVEGLKTLPDILF
KVQIPPAISVMGALVLALLMGLAVVWTNSKRTEELLMEFNNIVLTIVNKIIIPILPIFIA
TTFATLAYEGSITKQFPVFLKVIIIVLIGHYIWLTVLYTIAGIVSGKNPWKLLKHYGPAY
MTAVGTMSSAATLPVSLQCVRKSGVLDEEITNFAIPLGATTHLCGSVLTETFFVMVVSKI
LYGDVPAVGTMVLFIVLLGIFAVGAPGVPGGTVLASLGLIISVLGFDETGTALMITIFAL
QDSFGTACNITGDGALALILNGIFKKKQAN