Protein Info for HUW76_04680 in Fusobacterium nucleatum SB010

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF07715: Plug" amino acids 39 to 147 (109 residues), 75.2 bits, see alignment E=5.6e-25 PF00593: TonB_dep_Rec" amino acids 221 to 688 (468 residues), 154.1 bits, see alignment E=1.1e-48

Best Hits

KEGG orthology group: None (inferred from 89% identity to fnu:FN0768)

Predicted SEED Role

"Haemin uptake system outer membrane receptor" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (722 amino acids)

>HUW76_04680 TonB-dependent receptor (Fusobacterium nucleatum SB010)
MKKYLMGLSILIFCASAYGEVIDLGEKNIYSETGFEKNLRNSTTSPYIITSKDIETKGYT
SVSEILDSVPGVNVQEGLRPAVDVRGQGFQKAKATVQLLVDGVPANMLDTSHMNVPIDVV
NINEIERIEVIPGGGAVLYGSGTSGGVINIITKKYKGNNNVRGGVGYQLASFRNNKFDVS
AGTSVGNFDFDINYSKNRKHGYRDYDFTNSDYFSGRINYNINKTSNIAFKYSGYRDKYTY
PNFLDQKELDENRRQSGITKEKDENNKIKKDEFTLTYNTKIGDKNDLNILGFYQKTDIPS
EAIEDYTSEYKGMLAGQAAGLRKALSNPRLPARARTAMQNRLNTLLNELRTTNSVDFKTI
SEFKDTKKAIKIKDKFTYDNTGSNVVVGLGYTDNDMLRVSKMELVGKRVMADTKIDLSKK
TFEVFALNTYKISRVELIQGLRFENSKYDGTRKNNDDTLNIKKSKENWAGSLAVNYLYSD
TGNAYVKYERAFTSPAPGQLVDKVQTAPRVYTYKVNNLKSESTDLFEIGWNDYLLGSLLS
ADVFYAETKDEIATIFDGGAANAHGTAFRSTNLGKTKRYGFDLSAEQKFEKFTFKEAYSF
IETKILKDNSSSFEGKHIADVPRHKLVFSVDYDITSKFTVGADYEYRAAAFIDNTNKYGK
DKAKSVFNLRADYKLTNSLNIYAGINNIFGAKYYNSVGLSSGERIYDPAPRRNYYAGFKY
KF