Protein Info for HUW76_03920 in Fusobacterium nucleatum SB010

Annotation: UTP--glucose-1-phosphate uridylyltransferase GalU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01099: UTP--glucose-1-phosphate uridylyltransferase
  • amino acids 4 to 267 (264 residues), 356 bits, E=6.7e-111
• PF00483: NTP_transferase
  • amino acids 6 to 268 (263 residues), 117 bits, E=5.4e-38

Best Hits

Swiss-Prot: 51% identical to GTAB_STAEQ: UTP--glucose-1-phosphate uridylyltransferase (gtaB) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 94% identity to fnu:FN1266)

MetaCyc: 48% identical to UDP-glucose pyrophosphorylase (Mycoplasmoides pneumoniae M129)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (15/19 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose biosynthesis II (6/8 steps found)
• stachyose degradation (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (4/17 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Protein Sequence (294 amino acids)

>HUW76_03920 UTP--glucose-1-phosphate uridylyltransferase GalU (Fusobacterium nucleatum SB010)
MKKVTKAVIPAAGLGTRVLPATKALPKEMLTIVDKPSLQYIVEELVASGITDILIITGRN
KNSIEDHFDFSYELENTLKNDHKSELLNKVSHISNMANIYYVRQNMPLGLGHAILKAKSF
IGDEPFVIALGDDIIYNPEKPVAKQMIEKYELYGKSMIGCQEVAKEDVSKYGIAKLGNKL
DEATYQMLDFLEKPSVNDAPSRTACLGRYLLSGKVFKYLEETKPGKNGEIQLTDGILAMM
RDNEEVLAYNFIGKRYDIGSKFGLLKANIEFGLRNEETKEDIKEYLKKLDIKKI