Protein Info for HUW76_02855 in Fusobacterium nucleatum SB010

Annotation: dipeptidase PepV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR01887: putative dipeptidase" amino acids 11 to 447 (437 residues), 552.9 bits, see alignment E=3.6e-170 PF01546: Peptidase_M20" amino acids 80 to 448 (369 residues), 101.9 bits, see alignment E=4.8e-33 PF07687: M20_dimer" amino acids 243 to 354 (112 residues), 29.1 bits, see alignment E=8e-11

Best Hits

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 95% identity to fnu:FN0278)

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>HUW76_02855 dipeptidase PepV (Fusobacterium nucleatum SB010)
MDLKEKVLEYKDEVVKEIQNAVRVKSVKEAPLPGMPFGEGPAKALDHFMNLAKKLGFKTE
KFDNYAMHIDMGEGKETLGILAHVDVVPEGDNWTYPPYSGTIADGKIYGRGTLDDKGPAI
ISLFAMKAIADSGIKLNKKIRMILGADEESGSACLKYYFGELKMPYPDIAFTPDSSFPVT
YAEKGSVRVKIKKKFSTLKDVVIKGGNAFNSVPNEANGVIPVDMLGEVKNKNKVEFVKEG
NVYKIFSAGIPAHGAHPEKGYNAISALFEVLKDIEVKNEELKGLVAFFDKFIKMETDGKS
FGVKCTDGETGDLTLNLGKINLENNELEIWIDMRVPVKVKNEQIIETIKKNTEDYGYEFL
LHSNTQPLYVAKDSFLVSTLMNIYKELTGDNAAQPVAIGGGTYAKYAKNAVAFGALLPDQ
EDRMHQRDEYLEISKIDKLLQIYVEAIYRLAK