Protein Info for HMPREF1181_RS15085 in Bacteroides stercoris CC31F

Annotation: ATP synthase F1 subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01216: ATP synthase F1, epsilon subunit
  • amino acids 4 to 78 (75 residues), 75 bits, E=2.8e-25
• PF02823: ATP-synt_DE_N
  • amino acids 4 to 80 (77 residues), 86.3 bits, E=5.6e-29

Best Hits

Swiss-Prot: 39% identical to ATPE_CAUVC: ATP synthase epsilon chain (atpC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 69% identity to bfr:BF2172)

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (81 amino acids)

>HMPREF1181_RS15085 ATP synthase F1 subunit epsilon (Bacteroides stercoris CC31F)
MKGLHLDIVSPEKEIFTGEVDSVTLPGTLGSFTILVQHAPIVSSLKAGTLAYVTKDGEER
ALDIHGGFVEMNSNRVSVCID