Protein Info for HMPREF1181_RS15070 in Bacteroides stercoris CC31F

Annotation: ATP synthase F0 subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00137: ATP-synt_C
  • amino acids 19 to 81 (63 residues), 67.5 bits, E=4.9e-23
• TIGR01260: ATP synthase F0, C subunit
  • amino acids 28 to 84 (57 residues), 62.3 bits, E=1.7e-21

Best Hits

Swiss-Prot: 94% identical to ATPL_BACTN: ATP synthase subunit c (atpE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 92% identity to bfs:BF2231)

MetaCyc: 46% identical to ATP synthase Fo, c subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP synthase F0 sector subunit c"

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (85 amino acids)

>HMPREF1181_RS15070 ATP synthase F0 subunit C (Bacteroides stercoris CC31F)
MLLSVLLQAAAAGVGVSKLGAALGAGLAVIGAGMGIGKIGSSAMEAIARQPEASGDIRMN
MIIAAALIEGVALLAVVVCLLVFFL