Protein Info for HMPREF1181_RS14975 in Bacteroides stercoris CC31F

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 15 to 148 (134 residues), 38.2 bits, E=3e-13
• PF03721: UDPG_MGDP_dh_N
  • amino acids 15 to 191 (177 residues), 145.5 bits, E=2.8e-46
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 15 to 423 (409 residues), 442 bits, E=9.9e-137
• PF00984: UDPG_MGDP_dh
  • amino acids 214 to 304 (91 residues), 113.5 bits, E=8.2e-37
• PF03720: UDPG_MGDP_dh_C
  • amino acids 331 to 426 (96 residues), 71.9 bits, E=1e-23

Best Hits

Swiss-Prot: 49% identical to UGND_PSEAE: UDP-N-acetyl-D-glucosamine 6-dehydrogenase (wbpA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 75% identity to cst:CLOST_2337)

MetaCyc: 49% identical to UDP-N-acetyl-D-glucosamine 6-dehydrogenase monomer (Pseudomonas aeruginosa PAO1)
UDP-N-acetylglucosamine 6-dehydrogenase. [EC: 1.1.1.136]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-xylose biosynthesis (2/2 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-N-acetyl-α-D-galactosaminuronate biosynthesis (1/2 steps found)
• UDP-2,3-diacetamido-2,3-dideoxy-α-D-mannuronate biosynthesis (2/5 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.136 or 1.1.1.22

Protein Sequence (437 amino acids)

>HMPREF1181_RS14975 nucleotide sugar dehydrogenase (Bacteroides stercoris CC31F)
MKEKLLSRIAERKITVGVVGLGYVGLPLAVEKAKAGFRTIGFDVQEEKVKQVNAGHNYIG
DVVDAELAQLVRNGTLSATSDFSFIKDVDFVAICVPTPLDVHQEPDISYVESSAKSIAGH
LTAGTIVVLESTTYPGTTEELIKPILESGSGLKCGKDFYLGFSPERVDPGNAVYKTKNTP
KVVGAVGKDAQDVIAAMYGAVLGDKVHVVSSPAVAEMTKILENTYRNINIGLINELAILC
NRMGIDLWEVIEAAKTKPFGFTAFYPGPGLGGHCIPLDPYYLTWKAREYGFHTSMIEASM
MINDHMPEYTVERCGKILNRHRKALNGSRVLVLGVAYKQDIDDYRESPALRVIEELEKTG
ASVTFYDPYIPEFRYHGKSHKGEAALSAGLLRNTDLVVVTAAHTNVDYDFVQRYAHAVFD
TKNVMKAVAVRTNIEVL