Protein Info for HMPREF1181_RS14675 in Bacteroides stercoris CC31F

Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 6 to 185 (180 residues), 184.6 bits, E=5.5e-59
• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 15 to 200 (186 residues), 174.5 bits, E=7.9e-56

Best Hits

Swiss-Prot: 70% identical to THIE_BACV8: Thiamine-phosphate synthase (thiE) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 69% identity to pru:PRU_0400)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (217 amino acids)

>HMPREF1181_RS14675 thiamine phosphate synthase (Bacteroides stercoris CC31F)
MEKVQFITHYTERYSYLDSARMALEGGCRWIQLRMKDATENEILPVAAEVRKLCNDYGAI
FIIDDHVELVKEIRADGVHLGKNDMPVAEARRILGEEYIIGGTANTYEDVKKHWLDGVNY
IGCGPFRYTTTKQKLSPILGLEGYKEIIRQMRADNINLPIVAIGGITFADIPSVMQTGVT
GIALSGMVLRADNPVEEMQRILTETNQAGKINQTANY