Protein Info for HMPREF1181_RS14675 in Bacteroides stercoris CC31F
Annotation: thiamine phosphate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to THIE_BACV8: Thiamine-phosphate synthase (thiE) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 69% identity to pru:PRU_0400)Predicted SEED Role
"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
- superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
- thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
- thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
- thiamine diphosphate salvage II (4/5 steps found)
- thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
- thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
- thiamine diphosphate salvage V (2/3 steps found)
- superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
- thiamine diphosphate salvage IV (yeast) (4/7 steps found)
- thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.3
Use Curated BLAST to search for 2.5.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (217 amino acids)
>HMPREF1181_RS14675 thiamine phosphate synthase (Bacteroides stercoris CC31F) MEKVQFITHYTERYSYLDSARMALEGGCRWIQLRMKDATENEILPVAAEVRKLCNDYGAI FIIDDHVELVKEIRADGVHLGKNDMPVAEARRILGEEYIIGGTANTYEDVKKHWLDGVNY IGCGPFRYTTTKQKLSPILGLEGYKEIIRQMRADNINLPIVAIGGITFADIPSVMQTGVT GIALSGMVLRADNPVEEMQRILTETNQAGKINQTANY