Protein Info for HMPREF1181_RS09950 in Bacteroides stercoris CC31F

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF01637: ATPase_2" amino acids 3 to 210 (208 residues), 59.4 bits, see alignment E=7e-20 PF13173: AAA_14" amino acids 26 to 173 (148 residues), 30.3 bits, see alignment E=5.9e-11 PF03008: DUF234" amino acids 318 to 406 (89 residues), 49.4 bits, see alignment E=7.7e-17

Best Hits

KEGG orthology group: K06921, (no description) (inferred from 96% identity to osp:Odosp_3435)

Predicted SEED Role

"archaeal ATPase, fused to C-terminal DUF234 domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>HMPREF1181_RS09950 ATP-binding protein (Bacteroides stercoris CC31F)
MKFYNREKELASLEKVRQVSFSVHSQMTVLTGRRRIGKTSLIFKSCEDTPTVYLFVSRSN
EADLCLRFTSEIRQALDIYVPELTNFAEMFRFLMDLGTRMEYNLVIDEFQEFYYINQEIY
SLMQDTWDRLRKQSHVNLIVSGSVYTLMNKIFRDSKEPLYGRADSIMKLAPFTTSVLKEI
ISDHKADYTKDDLLALYTFTGGVPKYIEQFMDNGCTSMESMVDFMLQPDSSFLTEGQALL
IQEFGKKYGNYFSILSAISNGKNTLPEMEAVMGGMSLGGQLKRLEEDYDLVKKKRPILSK
EGSQTVRYEVLDMFLRFWFRYFIKYQNYIEIQNFERLADIIKKDYPTFSGLALEMYFRQQ
MMESKEFADIGSWWQGKNNKEQDEIDIVGLYAEEKKALVAEVKRQSKNFKPDLFALKVEE
LRKKVLFKYEIESRLFSMEDM