Protein Info for HMPREF1181_RS08625 in Bacteroides stercoris CC31F

Annotation: GtrA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details PF04138: GtrA" amino acids 12 to 120 (109 residues), 66.6 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: None (inferred from 79% identity to bvu:BVU_1077)

Predicted SEED Role

"FIG00407687: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>HMPREF1181_RS08625 GtrA family protein (Bacteroides stercoris CC31F)
MKHLKRFPEFIRFVMVGILATALHYGIYFLLQRFINVNIAYTLGYALSFIANFYLTAYFT
FGKKPSWSKAFGFGGAHLFNYLLHIGLLNTFLWLGLSKALAPIPVFAIAIPVNFLLVRFV
FKRKD