Protein Info for HMPREF1181_RS08190 in Bacteroides stercoris CC31F

Annotation: cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 20 to 409 (390 residues), 325.2 bits, see alignment E=4e-101 PF13091: PLDc_2" amino acids 58 to 167 (110 residues), 37.9 bits, see alignment E=1.5e-13 amino acids 253 to 376 (124 residues), 98.3 bits, see alignment E=3.2e-32 PF00614: PLDc" amino acids 146 to 168 (23 residues), 26.1 bits, see alignment (E = 6.3e-10) amino acids 323 to 349 (27 residues), 29.5 bits, see alignment (E = 5.4e-11)

Best Hits

KEGG orthology group: None (inferred from 81% identity to bhl:Bache_3296)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>HMPREF1181_RS08190 cardiolipin synthase (Bacteroides stercoris CC31F)
MRQISFIILFTFFIGSVRAQSTSDSLVMNYMQDMEIPLTYNNKVELLMTGREKFIDLFET
IRHARHHIHLEYFNFRNDSIANALFDLLAEKVKEGVEVRAMFDAFGNWSNNQPLKKHHLQ
AIKARGIELVKFDPITFPYINHAMHRDHRKIVVIDGKIGYTGGMNIADYYINGLPKIGKW
HDIHMHIEGDAVRYLQGIFLTMWNRETGQHIGGPAYFPNLPQFPDSIAEEIAIVDRTPRE
TPRSISHAYAVSIEAAQKNIQIVNPYFVPTKSIRKAIKKALKKGTEVEIMIPAVSDIPFT
PEASFYIAHKLMKRGAKIYLFKDGFHHSKVMMVDSAFCTVGTANLNSRSLRYDYETNAFI
FDPSTTNQLNSMFERDKKNSTLLTPEMWKKRSGWKKFLGWVGNLLTPFL