Protein Info for HMPREF1181_RS07890 in Bacteroides stercoris CC31F

Annotation: 16S rRNA processing protein RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR02273: 16S rRNA processing protein RimM" amino acids 8 to 169 (162 residues), 112.3 bits, see alignment E=7.8e-37 PF01782: RimM" amino acids 10 to 88 (79 residues), 34.4 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 81% identical to RIMM_BACFR: Ribosome maturation factor RimM (rimM) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 89% identity to bhl:Bache_3218)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>HMPREF1181_RS07890 16S rRNA processing protein RimM (Bacteroides stercoris CC31F)
MIRKEEVYKIGIFNKPHGIHGELSFTFTDDIFDRVEAEYLICLLDGIFVPFFIEEYRFRS
DTTALVKLEGVDTAERARMFTNIEVYFPVKHAEGAGPGELSWDFFVGFRMEEVHHGQLGE
VTDVDTSTINTLFVVDYKGEELLIPAQEDFIMDIDQKHKVITVNLPEGLLALDDTEEA