Protein Info for HMPREF1181_RS07865 in Bacteroides stercoris CC31F

Annotation: guanylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03263: guanylate kinase
  • amino acids 2 to 182 (181 residues), 213.4 bits, E=9.3e-68
• PF00625: Guanylate_kin
  • amino acids 2 to 178 (177 residues), 145 bits, E=2.1e-46

Best Hits

Swiss-Prot: 87% identical to KGUA_BACFN: Guanylate kinase (gmk) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K00942, guanylate kinase [EC: 2.7.4.8] (inferred from 91% identity to bhl:Bache_3212)

MetaCyc: 41% identical to guanylate kinase (Saccharomyces cerevisiae)
Guanylate kinase. [EC: 2.7.4.8]; T(2)-induced deoxynucleotide kinase. [EC: 2.7.4.8, 2.7.4.12, 2.7.4.13]

Predicted SEED Role

"Guanylate kinase (EC 2.7.4.8)" in subsystem MLST or Purine conversions (EC 2.7.4.8)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (20/26 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• dZTP biosynthesis (3/5 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (5/8 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (12/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (5/9 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (4/8 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (1/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (3/7 steps found)
• purine deoxyribonucleosides salvage (2/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (4/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (2/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (7/14 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.12 or 2.7.4.13 or 2.7.4.8

Protein Sequence (187 amino acids)

>HMPREF1181_RS07865 guanylate kinase (Bacteroides stercoris CC31F)
MGKLIIFSAPSGSGKSTIINYLLTQNLNLAFSISATSRPPRGTEQNGVEYFFLTPDEFRS
RIANDEFLEYEEVYQDRFYGTLKAQVEKQLAAGQNVVFDVDVVGGCNIKKFYGERALSVF
IQPPSVEELRKRLIGRGTDAPEVIESRVAKAEYELGFAPKFDTVIVNDDLETAKAEALKV
ITQFLNR