Protein Info for HMPREF1181_RS06510 in Bacteroides stercoris CC31F

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR00460: methionyl-tRNA formyltransferase" amino acids 7 to 315 (309 residues), 248.3 bits, see alignment E=5e-78 PF00551: Formyl_trans_N" amino acids 8 to 182 (175 residues), 123 bits, see alignment E=1.2e-39 PF02911: Formyl_trans_C" amino acids 212 to 314 (103 residues), 81.5 bits, see alignment E=4.5e-27

Best Hits

Swiss-Prot: 83% identical to FMT_BACFN: Methionyl-tRNA formyltransferase (fmt) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 85% identity to bhl:Bache_0051)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>HMPREF1181_RS06510 methionyl-tRNA formyltransferase (Bacteroides stercoris CC31F)
MMKKEDLRIVYMGTPEFAVEPLRCLVEGGYNIVGVITMPDKPAGRGHKVQFSPVKQYALE
HDLPLLQPERLKDEAFVEALRAWNADLQIVVAFRMLPEVVWNMPRLGTFNLHASLLPQYR
GAAPINWAVINGDTETGITTFFLKHEIDTGEVIQQVRVPIADTDNVGIVHDKLMMLGGRL
VTETVDAILADTVKSVPQEEMAVVGELRPAPKIFKDTCRIDWNQPVKRIYDFIRGLSPYP
AAWTELVQSDGTAVVLKIFETEKIEHLHESAPGTLQTDGKTYIRIAGTDGWIGVRALQLP
GKKRLKTDELLRGFKLTGECRVH