Protein Info for HMPREF1181_RS06420 in Bacteroides stercoris CC31F

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 PF05970: PIF1" amino acids 8 to 173 (166 residues), 96.6 bits, see alignment E=1.2e-30 PF13604: AAA_30" amino acids 18 to 220 (203 residues), 43.3 bits, see alignment E=2.5e-14 PF13245: AAA_19" amino acids 21 to 162 (142 residues), 41.7 bits, see alignment E=8.9e-14 PF14559: TPR_19" amino acids 543 to 596 (54 residues), 32.3 bits, see alignment 7.2e-11 PF13432: TPR_16" amino acids 543 to 597 (55 residues), 27.7 bits, see alignment 2.2e-09 amino acids 603 to 656 (54 residues), 24.3 bits, see alignment 2.6e-08 PF03704: BTAD" amino acids 543 to 659 (117 residues), 24.4 bits, see alignment E=2.3e-08 PF13431: TPR_17" amino acids 554 to 586 (33 residues), 24.5 bits, see alignment (E = 1.5e-08) PF13181: TPR_8" amino acids 566 to 597 (32 residues), 23.9 bits, see alignment (E = 2.2e-08) amino acids 602 to 632 (31 residues), 18.7 bits, see alignment (E = 1.1e-06) PF07719: TPR_2" amino acids 566 to 596 (31 residues), 24.8 bits, see alignment (E = 1.1e-08) PF00515: TPR_1" amino acids 566 to 596 (31 residues), 28.2 bits, see alignment (E = 8.2e-10) PF13371: TPR_9" amino acids 576 to 635 (60 residues), 35.7 bits, see alignment 4.9e-12

Best Hits

KEGG orthology group: None (inferred from 91% identity to bhl:Bache_1359)

Predicted SEED Role

"putative helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (669 amino acids)

>HMPREF1181_RS06420 AAA family ATPase (Bacteroides stercoris CC31F)
MSFVPDTQNKEFQDALNLIQYTRQSVFLTGKAGTGKSTFLRYICEHTKKKHVVLAPTGIA
AINAGGSTLHSFFKLPFYPLLPDDPNFSLQRGRIHEFFKYTKPHRKLLEELELVIIDEIS
MVRADIIDAVDRILRVYSRNLREPFGGKQILLVGDVFQLEPVVKGDERDILNRFYPTPYF
FSARVFGQIDLVSIELQTVYRQTDKVFVNVLDHIRSNTVGAADLQLLNTRYGTQIEQSEA
DMYITLATRRDNVDYINDKKLAELPGDPVTFHGEIMGDFPESSLPTSQELVLKPGAQIIF
IKNDFDRRWVNGTIGIVSGFDPIEETLYIITDDGKECDVKRESWRNIRYKYNEEKKQIEE
EELGTFTQYPVRLAWAITVHKSQGLTFSRVVIDFTGGVFAGGQAYVALSRCTSLEGIQLK
KPVSRADVFVRPEIVGFAQRFNNRQAIDRALKQAQADVQYVAAAKAFDQGDFETFLNEFF
KAIHSRYDIEKPVVQRLIRKKLNIINRLKAENVCLKQDMEKQRKRLQDYAREYYAMGNEC
ITQARDARAALANYDKALELYPEYTDAWVRKGVTLFNENQYQEAEECLNRAVRLRPAEFK
TVYNRGKLRLKLGNIEGAIADLDKATTLKPEHAGAHELFGDALMQTGKEVEAALQWRLAE
ELRKKRSSK