Protein Info for HMPREF1181_RS06315 in Bacteroides stercoris CC31F

Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF01209: Ubie_methyltran" amino acids 16 to 245 (230 residues), 218.2 bits, see alignment E=3.1e-68 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 21 to 245 (225 residues), 267.5 bits, see alignment E=3.7e-84 PF13489: Methyltransf_23" amino acids 52 to 171 (120 residues), 34 bits, see alignment E=7.3e-12 PF13847: Methyltransf_31" amino acids 61 to 173 (113 residues), 57.8 bits, see alignment E=3.4e-19 PF13649: Methyltransf_25" amino acids 63 to 159 (97 residues), 69.8 bits, see alignment E=7.8e-23 PF08242: Methyltransf_12" amino acids 64 to 161 (98 residues), 40.9 bits, see alignment E=8.4e-14 PF08241: Methyltransf_11" amino acids 65 to 163 (99 residues), 64.9 bits, see alignment E=2.6e-21

Best Hits

Swiss-Prot: 81% identical to MENG_BACTN: Demethylmenaquinone methyltransferase (menG) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 89% identity to bhl:Bache_1415)

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>HMPREF1181_RS06315 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE (Bacteroides stercoris CC31F)
MEYPQEHIKPYGNDGKKSEQVEEMFDNIAPAYDKLNHTLSMGIDRSWRKKAIDTLRPFSP
RRIMDVATGTGDFAILACRELQPDMLIGTDISEGMMNVGREKVKQAHLSDRISFAREDCT
SLSFADESFDAVTVAFGIRNFDRLDKGLSEMCRVLVPGGHLVILELSTPDRFPMKQLFTV
YSKAVIPLLGKFISKDNSAYTYLPQSIRAFPQGEIMQGVIRKAGFSEVRFKRLTFGICTL
YIAKK