Protein Info for HMPREF1181_RS05540 in Bacteroides stercoris CC31F

Annotation: SLC45 family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 392 to 418 (27 residues), see Phobius details amino acids 430 to 448 (19 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 266 (251 residues), 51.1 bits, see alignment E=9.8e-18 PF13347: MFS_2" amino acids 38 to 263 (226 residues), 43.5 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: None (inferred from 94% identity to bhl:Bache_3075)

Predicted SEED Role

"Sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>HMPREF1181_RS05540 SLC45 family MFS transporter (Bacteroides stercoris CC31F)
MKVKPDLSFWKLWNISFGFFGVQIAYALQSANISRIFSTLGADPHSLSYFWILPPLAGII
VQPIVGAASDRTWTRFGRRIPYLFIGSLVAVLVMCLLPNAGSFGMAVSTAMIFGLVSLMF
LDTSINMAMQPFKMMVGDMVNEKQKGLAYSIQSFLCNAGSLVGYLFPFIFAWVGISNTAP
QGVIPDSVIYSFYIGAAILIFCVIYTTVKVKEMPPAEYAQYHGITEEQEHEKINMLKLLV
KAPKAFWTVGLVQFFCWFAFMFMWTYTNGSIAANVFDAPTVENTVNGITKIVLDTKSLQY
QEAANWVGVLFAVQAIGSVLWAICIPMFKDRRFIYALSLVLGGIGFISTYFVHSPYVLFV
SFLLIGCAWAAMLALPFTILTNALSGGHMGTYLGLFNGTICIPQIVAAALGGSILALFTP
EGMLPPEINMLVTAGVMLIIGAACVYLIKETKGERA