Protein Info for HMPREF1181_RS02765 in Bacteroides stercoris CC31F

Annotation: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 21 to 481 (461 residues), 500.1 bits, see alignment E=3.6e-154 PF01225: Mur_ligase" amino acids 23 to 97 (75 residues), 47.5 bits, see alignment E=2.9e-16 PF08245: Mur_ligase_M" amino acids 109 to 305 (197 residues), 184.5 bits, see alignment E=3.5e-58 PF02875: Mur_ligase_C" amino acids 325 to 413 (89 residues), 70.7 bits, see alignment E=1.5e-23

Best Hits

Swiss-Prot: 89% identical to MURE_BACTN: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 93% identity to bhl:Bache_0479)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>HMPREF1181_RS02765 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase (Bacteroides stercoris CC31F)
MKLSELLKAIQPVQIIGSTEKDITGVNIDSRLVAAGHLFMAMRGTQTDGHAYIPTAIEKG
AIAVLCEDMPEETNPDVTYIQVKDSENAVGKVATTFYGDPTSKMELVGVTGTNGKTTIAT
LLYNTFRYFGYKVGLISTVCNYIDDRPVPTEHTTPDPITLNRLLGEMADSGCKYAFMEVS
SHSIAQQRISGLKFAGGIFTNLTRDHLDYHKTVENYLKAKKKFFDDMPKNAFSLTNLDDK
NGLVMTQNTRSRVYTYSLRSLSDFKGKVLESHFEGMLLDFNNHELAVRFIGKFNASNLLA
VFGAAVLLGKKEEDVLVALSTLHPVAGRFDSIRSPKGITAIVDYAHTPDALVNVLNAIHG
VLEGKGKVITVVGAGGNRDKGKRPIMAKESARLSDRVIITSDNPRFEEPQDIINDMLAGL
DKDDLQKTISIADRKEAIKTACMLAQPGDVILVAGKGHENYQEIKGVKHHFDDKEELKAI
MF