Protein Info for HMPREF1181_RS01070 in Bacteroides stercoris CC31F

Annotation: Gfo/Idh/MocA family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 60 to 186 (127 residues), 54 bits, see alignment E=2.8e-18 PF21252: Glyco_hydro_109_C" amino acids 199 to 341 (143 residues), 136.7 bits, see alignment E=5.9e-44

Best Hits

Swiss-Prot: 61% identical to G1091_BACFR: Glycosyl hydrolase family 109 protein 1 (BF0931) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: None (inferred from 61% identity to bfs:BF0853)

Predicted SEED Role

"Oxidoreductase, Gfo/Idh/MocA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>HMPREF1181_RS01070 Gfo/Idh/MocA family oxidoreductase (Bacteroides stercoris CC31F)
MKKNIPLIILAIACIVAGLFLAMDTHNEDTYTQCVTVSTPERPAGQRDVIGLSCPPIETV
RIGFIGLGSRGSEAIRRFTYQKGIEVKALCDLHQANVDTCQQMLLRANMPKATEYYGSED
AWKQVCEQPDIDLIYIATDWLHHTPMMVYAMEHGKHVACEVPAAMNMEEIWKTIDTAERT
RKHCMMLENCVYDFFEITTLNMAQQGLFGEITHVKGAYNHCLQEYWDDYNADWRMQYNIN
NRGDVYPTHGMGPACQLLNIHRGDRMKYLVAMDSNPFSLPEYLKEHGKGTEAQKLQNGEI
TLTLIRTEKGKTIQIEHNVASPRPYSRLYQLTGTKGFADKYPVEGYALNSKDLPQEITKE
QVFTAHEYMPEEIKSQLMNQYKDPIIKTMEEQAKEVGGHGGMDFIMDSRLIYCLHHGLPL
DMDVYDLAEWCSLIPLTKLSIENGSVPVEIPDFTRGNWNKVQGYRHAFIKAEKN