Protein Info for HMPREF1181_RS00505 in Bacteroides stercoris CC31F

Annotation: 30S ribosomal protein S19

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 TIGR01050: ribosomal protein uS19" amino acids 1 to 89 (89 residues), 143 bits, see alignment E=1.4e-46 PF00203: Ribosomal_S19" amino acids 3 to 83 (81 residues), 124.6 bits, see alignment E=5.8e-41

Best Hits

Swiss-Prot: 100% identical to RS19_BACV8: 30S ribosomal protein S19 (rpsS) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: None (inferred from 93% identity to pgt:PGTDC60_0204)

MetaCyc: 61% identical to 30S ribosomal subunit protein S19 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S19p (S15e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (89 amino acids)

>HMPREF1181_RS00505 30S ribosomal protein S19 (Bacteroides stercoris CC31F)
MSRSLKKGPYINVKLEKKVLAMNESGKKVVVKTWARASMISPDFVGHTVAVHNGNKFIPV
YVTENMVGHKLGEFAPTRTFRGHAGNKKK