Protein Info for HGI48_RS20260 in Dickeya dianthicola 67-19

Annotation: sodium/proline symporter PutP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details amino acids 456 to 474 (19 residues), see Phobius details TIGR02121: sodium/proline symporter" amino acids 7 to 491 (485 residues), 747.8 bits, see alignment E=5.3e-229 PF00474: SSF" amino acids 36 to 438 (403 residues), 464 bits, see alignment E=2.2e-143 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 36 to 438 (403 residues), 412.9 bits, see alignment E=1.6e-127

Best Hits

Swiss-Prot: 80% identical to PUTP_ECOLI: Sodium/proline symporter (putP) from Escherichia coli (strain K12)

KEGG orthology group: K11928, sodium/proline symporter (inferred from 98% identity to ddd:Dda3937_00257)

MetaCyc: 80% identical to proline:Na+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-118; TRANS-RXN0-505

Predicted SEED Role

"Proline/sodium symporter PutP (TC 2.A.21.2.1) @ Propionate/sodium symporter" (TC 2.A.21.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RIB8 at UniProt or InterPro

Protein Sequence (499 amino acids)

>HGI48_RS20260 sodium/proline symporter PutP (Dickeya dianthicola 67-19)
MTTMSTPLLVTFLVYIFGMVLIGLMAYRATNNFGDYILGGRRMGSVVTALSAGASDMSGW
LLMGLPGAVFLSGISESWIAIGLTIGAYLNWTWVAGRLRVHTEINHNALTLPDYFSHRFE
DKSKLLRVISALVILVFFTIYCASGIVAGARLFESTFGMSYDTALWAGAAATIAYTFIGG
YLAVSWTDTVQASLMIFALILTPVIVILSVGGITPSLAVIEAKSPANLDMFKGLDTVAIL
SLLGWGLGYFGQPHILARFMAADSHHTIRNARRISMTWMVLCLAGAVTVGFFGIAYFTGN
PTQAGNVSQNGERVFIELARLLFNPWIAGVLLSAILAAVMSTLSCQLLVCSSAITEDLYK
PFLRKNASQKELVWVGRVMVLLVSVVAIALAVNPENRVLGLVSYAWAGFGAAFGPVILIS
LLWPRMTRNGALVGMMVGAATVIIWKQYGWLNLYEIIPGFLLSCAAIVVVSLLGRAPSST
VTARFHQAEREFKSAPADA