Protein Info for HGI48_RS20135 in Dickeya dianthicola 67-19

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00497: SBP_bac_3" amino acids 38 to 258 (221 residues), 172.7 bits, see alignment E=4.2e-55

Best Hits

Swiss-Prot: 50% identical to YXEM_BACSU: Probable amino-acid-binding protein YxeM (yxeM) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 93% identity to ddc:Dd586_3888)

Predicted SEED Role

"Arginine ABC transporter, periplasmic arginine-binding protein ArtJ" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RK90 at UniProt or InterPro

Protein Sequence (269 amino acids)

>HGI48_RS20135 amino acid ABC transporter substrate-binding protein (Dickeya dianthicola 67-19)
MRTRLTRYLSAALFPLLAAVILVGCDNNKSAETQNKVLRLGTTGQSFPGSYKENGTLVGY
DVEVAEAIARKLGYQIAWTTADFSGLMGQLEAGKLDTVANNFVKTTERQKKYDFTNTYLT
YASQIVTSIENKDIQSMDDLKGKTVSGVLGSTHVTNLRNAFPNNDVTIRTYETRDGAMND
VINNRVQGYVNSRPILLAEINKRHLPLKLVGNPISNEQVSFPFAKTPEGNKLLAEFNQQL
QELRQNGQLKTLAEKYFGSDKVLESSQAE