Protein Info for HGI48_RS18340 in Dickeya dianthicola 67-19

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR00191: homoserine kinase" amino acids 2 to 306 (305 residues), 367.9 bits, see alignment E=1.5e-114 PF00288: GHMP_kinases_N" amino acids 84 to 150 (67 residues), 59.1 bits, see alignment E=4.7e-20 PF08544: GHMP_kinases_C" amino acids 211 to 287 (77 residues), 40.8 bits, see alignment E=2.4e-14

Best Hits

Swiss-Prot: 92% identical to KHSE_PECCP: Homoserine kinase (thrB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 98% identity to ddd:Dda3937_00393)

MetaCyc: 80% identical to homoserine kinase (Escherichia coli K-12 substr. MG1655)
Homoserine kinase. [EC: 2.7.1.39]; 2.7.1.- [EC: 2.7.1.39]

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RHB9 at UniProt or InterPro

Protein Sequence (309 amino acids)

>HGI48_RS18340 homoserine kinase (Dickeya dianthicola 67-19)
MVKIYAPASIGNVSVGFDVLGAAVSPVDGTLLGDCVIVQEAELFSLHNEGRFVSKLPDNP
KENIVYQCWERFCQEIGKTVPVAMTLEKNMPIGSGLGSSACSVVAGLMAMNEFCGKPLDD
TRLLTLMGELEGRISGSVHYDNVAPCFLGGIQLMVEEMGIVSQPVPGFDDWLWVMAYPGI
KVSTAEARAILPAQYRRQDCISHGRYLAGFIHACHTGQAALAATLMKDVIAEPYRTRLLP
GFAEARQAANELGALACGISGSGPTLFSVCNDMGAAQRLASWLRENYLQNDEGFVHICRL
DTAGARQLG