Protein Info for HGI48_RS17415 in Dickeya dianthicola 67-19

Annotation: HTH-type transcriptional regulator GalR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00356: LacI" amino acids 3 to 48 (46 residues), 72.6 bits, see alignment 3.6e-24 PF00532: Peripla_BP_1" amino acids 60 to 271 (212 residues), 82.8 bits, see alignment E=6.1e-27 PF13407: Peripla_BP_4" amino acids 63 to 276 (214 residues), 45 bits, see alignment E=2.1e-15 PF13377: Peripla_BP_3" amino acids 169 to 329 (161 residues), 115 bits, see alignment E=8.1e-37

Best Hits

Swiss-Prot: 76% identical to GALR_ECOLI: HTH-type transcriptional regulator GalR (galR) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 97% identity to ddd:Dda3937_02586)

Predicted SEED Role

"Galactose operon repressor, GalR-LacI family of transcriptional regulators" in subsystem Lactose and Galactose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RGY7 at UniProt or InterPro

Protein Sequence (336 amino acids)

>HGI48_RS17415 HTH-type transcriptional regulator GalR (Dickeya dianthicola 67-19)
MATIKDVARLAGVSVATVSRVINDSPKASAQARSAVLQAMQQLQYHPNANARALAQQSTE
TLGLVVSDVSDPFFGTMVKAVEQEAYRTGNFLLIGNGYHIAHKERQAIEQLIRHRCAALV
VHAKMLPDEELTPLMEQIPGMVLINRILPGYETRCVALDNRYGAWLATRHLILQGHRQIG
ILCSNHAISDADDRLTGYRDALAEHEIALDEQLIAYGEPDESGGEEAMITLLERGRPLTA
LTCYNDPMAAGALAVLSDNSIEVPRDMSLIGFDDVLLSRYLRPRLTTIRYPITAMATQAA
QIALALANGTPLPNAINLFHPTLIRRHSVAGLHNGH