Protein Info for HGI48_RS15560 in Dickeya dianthicola 67-19

Annotation: outer membrane protein assembly factor BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 6 to 392 (387 residues), 452.2 bits, see alignment E=5.7e-140 PF01011: PQQ" amino acids 71 to 99 (29 residues), 25.9 bits, see alignment (E = 9e-10) amino acids 121 to 158 (38 residues), 27.4 bits, see alignment 2.9e-10 amino acids 161 to 195 (35 residues), 21.1 bits, see alignment 2.9e-08 amino acids 257 to 289 (33 residues), 22.1 bits, see alignment 1.4e-08 PF13360: PQQ_2" amino acids 78 to 320 (243 residues), 206.9 bits, see alignment E=5.3e-65 amino acids 303 to 392 (90 residues), 33.1 bits, see alignment E=7e-12 PF13570: PQQ_3" amino acids 89 to 139 (51 residues), 24.5 bits, see alignment 4.4e-09 amino acids 140 to 176 (37 residues), 31.8 bits, see alignment 2.1e-11 amino acids 225 to 275 (51 residues), 19 bits, see alignment 2.4e-07

Best Hits

Swiss-Prot: 76% identical to BAMB_YERPE: Outer membrane protein assembly factor BamB (bamB) from Yersinia pestis

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03708)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RGF1 at UniProt or InterPro

Protein Sequence (393 amino acids)

>HGI48_RS15560 outer membrane protein assembly factor BamB (Dickeya dianthicola 67-19)
MQLRKTLLVGLVSVTLLSGCSLFDREEDVVKMSPLPQVTNQFTPTKVWSRSVGDGIGEFY
SNLHPIWQDSRVYAADRHGTVKALDLNSGEEKWRADLAEKTGLLSSNRPALLSGGVAVSG
NHVYVGSERAQLFALNADDGTLQWQTKVAGEVLSSPVVSDGMVIIHTSNGMLQALSESDG
TIKWTVNLDMPSLSLRGESAPTAAFGAAIVGGDNGRVSAVMINQGQLIWQQRISQPGGAT
EIARLNDVDTTPVVASNVVYALGYNGNLTALDLRSGQISWKREIGSVNDFIVDGDRIYLV
DQDDRITALNTNGGVVIWRQGDLLHRNLTAPALYNGYLVVGDAEGYLHWVNTTDGRFVAQ
QKVDGSGLLSKPVVASDKLLVQAKDGEVYAFTR