Protein Info for HGI48_RS15240 in Dickeya dianthicola 67-19

Annotation: universal stress protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF00582: Usp" amino acids 1 to 142 (142 residues), 105.2 bits, see alignment E=2.2e-34

Best Hits

Swiss-Prot: 45% identical to USPG_ECO57: Universal stress protein G (uspG) from Escherichia coli O157:H7

KEGG orthology group: K11932, universal stress protein G (inferred from 97% identity to ddd:Dda3937_01695)

Predicted SEED Role

"Universal stress protein G" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CM37 at UniProt or InterPro

Protein Sequence (142 amino acids)

>HGI48_RS15240 universal stress protein (Dickeya dianthicola 67-19)
MYKTILVPVDIDEDALTQKALSHAVALARQSGATVHLFHALPDASAFMSAYSFGIKEFEN
EAVIKADEKLHTLMKTIDLPAEKLSHSISFGIPRDEVLELAQEIGADLIVIGSRRPNVKT
YLLGSNAAAIVRHAQTSVLVVR