Protein Info for HGI48_RS13765 in Dickeya dianthicola 67-19

Annotation: hydroxymethylglutaryl-CoA synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01154: HMG_CoA_synt_N
  • amino acids 3 to 179 (177 residues), 38.9 bits, E=9e-14
• PF08540: HMG_CoA_synt_C
  • amino acids 275 to 404 (130 residues), 44.9 bits, E=1.2e-15

Best Hits

Swiss-Prot: 66% identical to PKSG_BACSU: Polyketide biosynthesis 3-hydroxy-3-methylglutaryl-ACP synthase PksG (pksG) from Bacillus subtilis (strain 168)

KEGG orthology group: K01641, hydroxymethylglutaryl-CoA synthase [EC: 2.3.3.10] (inferred from 95% identity to dda:Dd703_1418)

MetaCyc: 66% identical to hydroxymethylglutaryl-[acp] synthase CurD (Moorena producens 3L)
2.3.3.g [EC: 2.3.3.g]

Predicted SEED Role

"Hydroxymethylglutaryl-CoA synthase (EC 2.3.3.10)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or Ketoisovalerate oxidoreductase or Leucine Degradation and HMG-CoA Metabolism (EC 2.3.3.10)

MetaCyc Pathways

• ketogenesis (3/5 steps found)
• ferrichrome A biosynthesis (2/5 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (5/10 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
• mevalonate pathway II (haloarchaea) (2/7 steps found)
• isoprene biosynthesis II (engineered) (2/8 steps found)
• mevalonate pathway III (Thermoplasma) (2/8 steps found)
• mevalonate pathway IV (archaea) (2/8 steps found)
• pederin biosynthesis (3/14 steps found)
• bryostatin biosynthesis (4/19 steps found)
• mupirocin biosynthesis (4/26 steps found)
• superpathway of ergosterol biosynthesis I (4/26 steps found)
• curacin A biosynthesis (1/22 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)
• corallopyronin A biosynthesis (3/30 steps found)
• superpathway of cholesterol biosynthesis (4/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.10 or 2.3.3.g

Sequence Analysis Tools

See A0A7L9RF26 at UniProt or InterPro

Protein Sequence (420 amino acids)

>HGI48_RS13765 hydroxymethylglutaryl-CoA synthase family protein (Dickeya dianthicola 67-19)
MISVGIEAINAFCGTSYINVRDLAQHRQLDMSRFDNLLMKQKTVSLPCEDPVSFAVNAAK
PILDALSEQEKNSIELLITCTESGIDFGKSISTYVHHYLGLKRNCRLFELKTACYSGVAG
LQMAVNTILSQASPGSKALVIATDMTRFILEEENGDHTSQDWSFAEPSGGSGAVAMLVSD
APHVFQIDVGANGYYGYEVMDTCRPVPDRETGDSDLSLLAYLECCEKAYLEYEKRVAGID
YVNTFGYLAFHTPFGGMVKGAHRNMMRKLVRAAPQDTEADFNRRVTPGLNYCQRVGNIMG
ATLALSLLSTLSNADIHSPQRIGCFSYGSGCCSEFFSGVVTPEGCQRVRQMEIGAHLDRR
RELTMSEYDALLYGNHEVRFGTKNVTLDLSRFPQIHSATQEAHHLVLRRINEFHREYEWV